RPS-BLAST 2.2.4 [Aug-26-2002] Query= gi|1786183|gb|AAC73113.1| (AE000111) aspartokinase I, homoserine dehydrogenase I [Escherichia coli] (820 letters) Score E Sequences producing significant alignments: (bits) Value gnl|CDD|3919 smart00483, POLXc, DNA polymerase X family; include... 28 0.064 gnl|CDD|7379 smart00533, MUTSd, DNA-binding domain of DNA mismat... 26 0.47 gnl|CDD|178 smart00202, SR, Scavenger receptor Cys-rich; The sea... 22 4.5 gnl|CDD|8977 smart00359, PUA, Putative RNA-binding Domain in Pse... 22 7.0 gnl|CDD|7370 smart00486, POLBc, DNA polymerase type-B family; DN... 22 7.6 gnl|CDD|28 smart00035, CLa, CLUSTERIN alpha chain; 21 7.6 gnl|CDD|8994 smart00450, RHOD, Rhodanese Homology Domain; An alp... 22 8.0 >gnl|CDD|3919 smart00483, POLXc, DNA polymerase X family; includes vertebrate polymerase beta and terminal deoxynucleotidyltransferases Length = 335 Score = 28.3 bits (63), Expect = 0.064 Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 599 SRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILSGSLSYIFGKLDEGMSFSE 655 ++RK Y V+++L +N+ +L GI I ++ G Sbjct: 23 NKRKCSY---FRKAASVLKSLPFPINSMKDLKGLPGIGDKIKKKIEEIIETGKLSKA 76 >gnl|CDD|7379 smart00533, MUTSd, DNA-binding domain of DNA mismatch repair MUTS family; Length = 310 Score = 25.7 bits (56), Expect = 0.47 Identities = 19/107 (17%), Positives = 36/107 (32%), Gaps = 21/107 (19%) Query: 9 TSVANAERFLR------VADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDALP 62 +R LR + D+ E N R L+ E + L Sbjct: 13 CKTPMGKRLLRRWLLQPLTDLKEINERL-----------DAVEELLENPELRQDLRGLLK 61 Query: 63 NISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGIS 109 I D ER+ + + A+ + L +L ++ +I+ +L + Sbjct: 62 RIPDLERLLSRIKLSRASPR---DLLRLYDSLEG-LKEIRKLLESLE 104 >gnl|CDD|178 smart00202, SR, Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO Length = 101 Score = 22.2 bits (47), Expect = 4.5 Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 648 DEGMSFSEATTLAREMGYTEP--DPRDDLSGMDVARKLLILARETGRELELAD 698 D+G +A + R++G+ G L R TG E L+D Sbjct: 27 DDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCTGTEASLSD 79 >gnl|CDD|8977 smart00359, PUA, Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase; Length = 78 Score = 21.8 bits (46), Expect = 7.0 Identities = 10/40 (25%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Query: 135 AGVLEARGH-----NVTVIDPVEKLLAVGHYLESTVDIAE 169 GV+ G V ++D + L +G S+ +IA Sbjct: 22 PGVVRVDGDIKEGDVVVIVDEKGEPLGIGLANMSSEEIAR 61 >gnl|CDD|7370 smart00486, POLBc, DNA polymerase type-B family; DNA polymerase alpha, delta, epsilon and zeta chain (eukaryota), DNA polymerases in archaea, DNA polymerase II in e. coli, mitochondrial DNA polymerases and and virus DNA polymerases Length = 475 Score = 21.7 bits (45), Expect = 7.6 Identities = 8/33 (24%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Query: 247 KSMSYQEAMELSYFGAKVLHPRTI---TPIAQF 276 K + + ++ Y G KVL P+ P+ Sbjct: 275 KGLEPELKKKVKYEGGKVLEPKKGFYENPVLVL 307 >gnl|CDD|28 smart00035, CLa, CLUSTERIN alpha chain; Length = 215 Score = 21.5 bits (45), Expect = 7.6 Identities = 7/13 (53%), Positives = 9/13 (68%) Query: 479 ALLEQLKRQQSWL 491 +LLEQL Q W+ Sbjct: 129 SLLEQLNEQFGWV 141 >gnl|CDD|8994 smart00450, RHOD, Rhodanese Homology Domain; An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions Length = 109 Score = 21.7 bits (45), Expect = 8.0 Identities = 14/56 (25%), Positives = 17/56 (30%) Query: 520 NWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVV 575 E L + E +L + PVIV C S A GF V Sbjct: 38 PLSELLDRRGETDSLFEELLGSLGLDKDKPVIVYCRSGNRSAKAAWLLRELGFKNV 93 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0574 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 1100, Extension: 100 Number of Hits to DB: 194,372 Number of Sequences: 0 Number of extensions: 14001 Number of successful extensions: 17 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 438 length of database: 75,508 effective HSP length: 68 effective length of query: 438 effective length of database: 31,988 effective search space: 14010744 effective search space used: 24054976 T: 11 A: 40 X1: 1600 (737.2 bits) X2: 3800 (1463.8 bits) X3: 6400 (2465.3 bits) S1: 4100 (1892.0 bits) S2: 43 (20.7 bits)