TBLASTX 2.1.2 [Oct-19-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= HUMBETGLOA Human haplotype C4 beta-globin gene, complete cds. (3002 letters) Database: ecoli.nt 400 sequences; 4,662,239 total letters Searching.................................................done Score E Sequences producing significant alignments: (bits) Value gb|AE000479.1|AE000479 Escherichia coli K-12 MG1655 section 369 ... 34 0.13 gb|AE000302.1|AE000302 Escherichia coli K-12 MG1655 section 192 ... 31 0.61 gb|AE000277.1|AE000277 Escherichia coli K-12 MG1655 section 167 ... 31 0.84 gb|AE000168.1|AE000168 Escherichia coli K-12 MG1655 section 58 o... 29 2.2 gb|AE000400.1|AE000400 Escherichia coli K-12 MG1655 section 290 ... 29 3.0 gb|AE000408.1|AE000408 Escherichia coli K-12 MG1655 section 298 ... 29 3.0 gb|AE000438.1|AE000438 Escherichia coli K-12 MG1655 section 328 ... 29 3.0 gb|AE000396.1|AE000396 Escherichia coli K-12 MG1655 section 286 ... 29 3.0 gb|AE000466.1|AE000466 Escherichia coli K-12 MG1655 section 356 ... 26 3.4 gb|AE000482.1|AE000482 Escherichia coli K-12 MG1655 section 372 ... 29 4.1 gb|AE000341.1|AE000341 Escherichia coli K-12 MG1655 section 231 ... 29 4.1 gb|AE000198.1|AE000198 Escherichia coli K-12 MG1655 section 88 o... 29 4.1 gb|AE000367.1|AE000367 Escherichia coli K-12 MG1655 section 257 ... 29 4.1 gb|AE000136.1|AE000136 Escherichia coli K-12 MG1655 section 26 o... 29 4.1 gb|AE000327.1|AE000327 Escherichia coli K-12 MG1655 section 217 ... 28 5.7 gb|AE000498.1|AE000498 Escherichia coli K-12 MG1655 section 388 ... 28 7.8 gb|AE000509.1|AE000509 Escherichia coli K-12 MG1655 section 399 ... 28 7.8 gb|AE000306.1|AE000306 Escherichia coli K-12 MG1655 section 196 ... 28 7.8 gb|AE000203.1|AE000203 Escherichia coli K-12 MG1655 section 93 o... 28 7.8 gb|AE000208.1|AE000208 Escherichia coli K-12 MG1655 section 98 o... 28 7.8 >gb|AE000479.1|AE000479 Escherichia coli K-12 MG1655 section 369 of 400 of the complete genome Length = 10934 Score = 33.6 bits (67), Expect = 0.13 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 / -2 Query: 1057 SAYWSIFPPLGCWWSTLGPRGSLSPL 1134 +A W++FPP+G W L + SPL Sbjct: 5893 AAVWALFPPVGSQWGCLASQWRTSPL 5816 >gb|AE000302.1|AE000302 Escherichia coli K-12 MG1655 section 192 of 400 of the complete genome Length = 10264 Score = 31.3 bits (62), Expect = 0.61 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 / +2 Query: 2177 WSVCWPITLAKNSPHQC 2227 + CWP+ L ++SP+QC Sbjct: 1157 YPACWPLPLRRSSPYQC 1207 >gb|AE000277.1|AE000277 Escherichia coli K-12 MG1655 section 167 of 400 of the complete genome Length = 11653 Score = 30.8 bits (61), Expect = 0.84 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 / -3 Query: 2174 CWSVCWPITLAKNSPHQCRLPIRKW 2248 CW + L K+ P QCR+ + +W Sbjct: 4931 CWLTASVLRLQKSLPRQCRITVVRW 4857 >gb|AE000168.1|AE000168 Escherichia coli K-12 MG1655 section 58 of 400 of the complete genome Length = 12663 Score = 29.5 bits (58), Expect = 2.2 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -1 / +1 Query: 2813 KEHFRGKVVSLSKRTEWSQG*EMQDKQMGSEKTFMRTAKTI 2691 K H RG+ V + ++ ++ E+ D++ G+ + RT +TI Sbjct: 13 KRHLRGE*VKVGEKYITARRGELPDQEPGNGEASYRTMRTI 135 >gb|AE000400.1|AE000400 Escherichia coli K-12 MG1655 section 290 of 400 of the complete genome Length = 14295 Score = 29.0 bits (57), Expect = 3.0 Identities = 7/18 (38%), Positives = 10/18 (54%) Frame = +2 / +3 Query: 2165 WATCWSVCWPITLAKNSP 2218 W TCW+ CW ++P Sbjct: 9096 WITCWNCCWQAGWISSAP 9149 >gb|AE000408.1|AE000408 Escherichia coli K-12 MG1655 section 298 of 400 of the complete genome Length = 10944 Score = 29.0 bits (57), Expect = 3.0 Identities = 17/39 (43%), Positives = 20/39 (50%) Frame = -3 / +1 Query: 1020 LSPHAQFLLVSLNLSCNLDTNLPRASPPTSSTFTLPHRA 904 L+ A FLLV + +S DT LPR T TF RA Sbjct: 7618 LTSTAAFLLV*VKISRACDTFLPRIRSATRRTF*AEERA 7734 >gb|AE000438.1|AE000438 Escherichia coli K-12 MG1655 section 328 of 400 of the complete genome Length = 10426 Score = 29.0 bits (57), Expect = 3.0 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +3 Query: 2165 WATCWSVCWPITLAKNSPHQCRLPIRKW 2248 WA CW C + +A NS R W Sbjct: 750 WACCWRTCSLVVVALNSLRAVRQSSTSW 833 >gb|AE000396.1|AE000396 Escherichia coli K-12 MG1655 section 286 of 400 of the complete genome Length = 10098 Score = 29.0 bits (57), Expect = 3.0 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -3 / -1 Query: 633 PPSKIYLLAPYHQYKLLLKTSSFASVF 553 PP++ YLL+P H+++++ S + F Sbjct: 309 PPARFYLLSPVHEWRVIAS*SWYHQSF 229 >gb|AE000466.1|AE000466 Escherichia coli K-12 MG1655 section 356 of 400 of the complete genome Length = 10208 Score = 26.3 bits (51), Expect(2) = 3.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 / +2 Query: 2796 SPEVFLPCFTARWFLLAWPLSLSCLC 2873 S V L C T ++L W L+LS C Sbjct: 5579 SSAVVLRCLTTVFWLPVWALTLSICC 5656 Score = 20.3 bits (38), Expect(2) = 3.4 Identities = 4/11 (36%), Positives = 7/11 (63%) Frame = +3 / +1 Query: 2892 LKKEKQGSWFD 2924 +K+ +G W D Sbjct: 5737 MKRPFKGDWLD 5769 >gb|AE000482.1|AE000482 Escherichia coli K-12 MG1655 section 372 of 400 of the complete genome Length = 20906 Score = 28.6 bits (56), Expect = 4.1 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +3 / +1 Query: 660 SQCQKSQGQVRLSSLRPHPVEPHPRVGQSTPRSREGRSQGWA*KSGQS 803 S+C G R RP + P +P GR +GW GQ+ Sbjct: 20239 SRCALILGPARRWVHRPESLSPAASAHGQSPHVAAGRRRGWKRADGQN 20382 >gb|AE000341.1|AE000341 Escherichia coli K-12 MG1655 section 231 of 400 of the complete genome Length = 10231 Score = 28.6 bits (56), Expect = 4.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 / +2 Query: 2995 PGD*HCRFRVTVSGGGREEG 2936 PG H +R TVSG GRE G Sbjct: 7538 PGWLHAVYRETVSGSGREAG 7597 >gb|AE000198.1|AE000198 Escherichia coli K-12 MG1655 section 88 of 400 of the complete genome Length = 11639 Score = 28.6 bits (56), Expect = 4.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 / +3 Query: 2332 FPKSNY*TGGYYEGP*ASGFCL 2397 F +S * GGY+ GP +S FC+ Sbjct: 10947 FQRSGG*PGGYHAGPGSSPFCV 11012 >gb|AE000367.1|AE000367 Escherichia coli K-12 MG1655 section 257 of 400 of the complete genome Length = 11438 Score = 28.6 bits (56), Expect = 4.1 Identities = 8/27 (29%), Positives = 13/27 (47%) Frame = +3 / -2 Query: 1332 CFLSPSFLWLSSCHRKGISNRVQFRMG 1412 C + +F+W + CH+ I F G Sbjct: 7990 CLFAAAFVWFAKCHQPVIGRNTTFSKG 7910 >gb|AE000136.1|AE000136 Escherichia coli K-12 MG1655 section 26 of 400 of the complete genome Length = 16823 Score = 28.6 bits (56), Expect = 4.1 Identities = 11/23 (47%), Positives = 12/23 (51%) Frame = -2 / +1 Query: 2860 RLSGQARRNHLAVKHGRNTSGER 2792 RLSG+ RR A H SG R Sbjct: 13873 RLSGKVRRRGSAASHFLYLSGSR 13941 >gb|AE000327.1|AE000327 Escherichia coli K-12 MG1655 section 217 of 400 of the complete genome Length = 10048 Score = 28.1 bits (55), Expect = 5.7 Identities = 9/19 (47%), Positives = 12/19 (62%) Frame = +1 / +2 Query: 1231 WTTSRAPLPH*VSCTVTSC 1287 W S P+PH C+V+SC Sbjct: 2426 WRQSLYPIPHCYRCSVSSC 2482 >gb|AE000498.1|AE000498 Escherichia coli K-12 MG1655 section 388 of 400 of the complete genome Length = 10264 Score = 27.6 bits (54), Expect = 7.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 / +3 Query: 2670 YAVFYITYCFSCPHECLF 2723 + + T C SCPH C F Sbjct: 4278 FITLHFT*CVSCPHNCSF 4331 >gb|AE000509.1|AE000509 Escherichia coli K-12 MG1655 section 399 of 400 of the complete genome Length = 10589 Score = 27.6 bits (54), Expect = 7.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 / -3 Query: 682 PWLFWHWLRSWTSNPQP 632 P L W+W+R S+P+P Sbjct: 261 PSLLWYWVRRCLSSPRP 211 >gb|AE000306.1|AE000306 Escherichia coli K-12 MG1655 section 196 of 400 of the complete genome Length = 10446 Score = 27.6 bits (54), Expect = 7.8 Identities = 7/18 (38%), Positives = 12/18 (65%) Frame = +3 / +1 Query: 1341 SPSFLWLSSCHRKGISNR 1394 +P+ W+S CHR+ + R Sbjct: 136 TPAGCWISGCHRRSVQQR 189 >gb|AE000203.1|AE000203 Escherichia coli K-12 MG1655 section 93 of 400 of the complete genome Length = 10751 Score = 27.6 bits (54), Expect = 7.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 / +3 Query: 1156 LLWATLR*RLMARKCSVPLVMAWLTWTTSRAPLPH*VSCTVTSCTWI 1296 +L T R A + +V + WT S P P + C+++S +W+ Sbjct: 1554 ILRLTYRLPTWAEPVTWAMVSSMRVWTPSVRP*PEALICSISSGSWL 1694 >gb|AE000208.1|AE000208 Escherichia coli K-12 MG1655 section 98 of 400 of the complete genome Length = 10619 Score = 27.6 bits (54), Expect = 7.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 / +3 Query: 981 LSCNLDTNLPRASPPTSSTFTLPHR 907 ++C L + P ++TFTLPHR Sbjct: 2829 VACTLTCKYRLSLPQRANTFTLPHR 2903 Database: ecoli.nt Posted date: Jun 14, 2001 3:27 PM Number of letters in database: 4,662,239 Number of sequences in database: 400 Lambda K H 0.318 0.135 0.401 Matrix: BLOSUM62 Number of Hits to DB: 31907970 Number of Sequences: 400 Number of extensions: 491769 Number of successful extensions: 23184 Number of sequences better than 10.0: 20 length of query: 1000 length of database: 1,554,079 effective HSP length: 47 effective length of query: 953 effective length of database: 1,535,279 effective search space: 1463120887 effective search space used: 1463120887 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 0 ( 0.0 bits) S1: 41 (21.7 bits) S2: 53 (27.2 bits)